ABclonal
Recombinant Mouse Placenta growth factor/PLGF/PGF Protein - RP01941
Recombinant Mouse Placenta growth factor/PLGF/PGF Protein - RP01941
Couldn't load pickup availability
Recombinant Mouse Placenta growth factor/PLGF/PGF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01941-10, RP01941-20, RP01941-50, RP01941-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Placenta growth factor/PLGF/PGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Pro158) of Mouse Placenta growth factor/PLGF/PGF(Accession #NP_032853.1) fused with a Avi&His tag at the C-terminus.
Alternate Names: Pgf, Plgf, Placenta growth factor, PlGF
SWISS: P49764
GeneID: 18654
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines. Alternative splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively. Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus. Human PlGF-1 shares 56%, 55%, 74% and 95% aa identity with the comparable isoform of mouse, rat, canine, and equine PlGF, respectively. PlGF is mainly found as variably glycosylated, secreted, 55-60 kDa disulfide linked homodimers. Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes, and some endothelial cells. Circulating PlGF increases during pregnancy, reaching a peak in mid-gestation; this increase is attenuated in preeclampsia. However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia.
Source: HEK293 cells
Tag: C-Avi&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
