ABclonal
Recombinant Mouse Pleiotrophin/PTN Protein - RP00791
Recombinant Mouse Pleiotrophin/PTN Protein - RP00791
Couldn't load pickup availability
Recombinant Mouse Pleiotrophin/PTN Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00791-10, RP00791-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Pleiotrophin/PTN Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly33-Asp168) of mouse Pleiotrophin/PTN (Accession #P63089) fused with a 6×His tag at the C-terminus.
Alternate Names: Pleiotrophin; PTN; Heparin-binding brain mitogen; HBBM; Heparin-binding growth factor 8; HBGF-8; Osteoblast-specific factor 1; OSF-1;
SWISS: P63089
GeneID: 19242
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Pleiotrophin (PTN) is a secreted, strongly heparinbinding, developmentally regulated cytokine. PTN is a highlyconserved protein , Human, mouse, rat, canine, porcine, equine and bovine PTN share 98% aa sequenceidentity or greater. PTN and midkine share 50% amino acid (aa) sequence identity, share some functions, andconstitute a family. During development, PTN is involved in development of brain, bone, and organsundergoing branching morphogenesis. PTN causes PTPRB dimerization and inactivates its phosphatase activity,which allows increased tyrosine phosphorylation of its substrates. Increased expression of PTN is correlatedwith neuronal development or stresses such as brain ischemia and Parkinson’s disease.
Bio-Activity: Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cerebral cortical neurons. Optimal neurite outgrowth was observed when neurons were plated on 96 well culture plates that had been pre-coated with 100 μL/well of Recombinant Mouse Pleiotrophin/PTN at 3-8 μg/mL.
Source: HEK293 cells
Tag: C-6×His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
