ABclonal
Recombinant Mouse/Rat Mature TGF-beta 2 Protein - RP00672
Recombinant Mouse/Rat Mature TGF-beta 2 Protein - RP00672
Couldn't load pickup availability
Recombinant Mouse/Rat Mature TGF-beta 2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00672-10, RP00672-20, RP00672-50, RP00672-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse TGF-beta 2/TGFB2 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala303-Ser414) of mouse TGF-beta 2/TGFB2 (Accession #P27090).
Alternate Names: TGFB2; BSC-1 cell growth inhibitor; Cetermin; Glioblastoma-derived T-cell suppressor factor; G-TSF; MGC116892; Polyergin; TGF-beta2; TGF-beta-2; transforming growth factor beta-2
SWISS: P27090
GeneID: 21808
Species: Mouse/Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Transforming growth factor beta 2 (TGF- β 2) is a member of TGF-beta superfamily that shares a characteristiccysteine knot structure. Mice with TGF- β 2 gene deletion show defects in development of cardiac, lung,craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF-β isoforms signal via the sameheteromeric receptor complex, consisting of a ligand binding TGF- β receptor type II (T β R-II), and a TGF- βreceptor type I (T β R-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- βexpression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney,gut, liver, eye, ear, skin, and the nervous system.
Bio-Activity: Recombinant Mouse/Rat Mature TGF-beta 2 Protein inhibit the IL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is 0.062-0.248 ng/mL, corresponding to a specific activity of 4.03×106~1.61×107 units/mg.
Source: HEK293 cells
Tag: No tag
Formulation: Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.Contact us for customized product form or formulation.
Antigen Sequence: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
