Skip to product information
1 of 1

ABclonal

Recombinant Mouse RETN Protein - RP01873

Recombinant Mouse RETN Protein - RP01873

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse RETN Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01873-10, RP01873-20, RP01873-50, RP01873-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse RETN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Ser114 ) of Mouse RETN (Accession #NP_075360.1) fused with hFc tag at the N-terminus.

Alternate Names: Resistin, Adipose tissue-specific secretory factor, ADSF, Adipose-specific cysteine-rich secreted protein A12-alpha, Cysteine-rich secreted protein FIZZ3, Retn, Fizz3

SWISS: Q99P87

GeneID: 57264

Species: Mouse

Purity: ≥ 95% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Resistin is an adipocytokine, which has been studied for its role in insulin resistance and recently in inflammation. The RETN and CAP1 polymorphisms and gene expression may be potential biomarkers for breast cancer risk. Resistin (RETN), recently found to be relevant to inflammation and inflammatory disorders.

Source: HEK293 cells

Tag: N-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details