ABclonal
Recombinant Mouse Sclerostin/SOST Protein - RP02845
Recombinant Mouse Sclerostin/SOST Protein - RP02845
Couldn't load pickup availability
Recombinant Mouse Sclerostin/SOST Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP02845-10, RP02845-50, RP02845-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Sclerostin/SOST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Tyr211) of mouse Sclerostin/SOST (Accession #NP_077769.4) fused with a His tag at the C-terminus.
Alternate Names: SOST, CDD, DAND6, SOST1, VBCH
SWISS: Q99P68
GeneID: 74499
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
