Recombinant Mouse Siglec-10 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP03262-10, RP03262-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Siglec-10 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met19-Lys543) of mouse Siglec-10 (Accession #Q80ZE3) fused with hFc tag at the C-terminus.
Alternate Names: SIGLEC10; SiglecG; Siglec-G; MGC126774; PRO940; Siglec10; SLG2; sialic acid-binding Ig-like lectin 10; Siglec-10; siglec-like gene 2; Siglec-like protein 2; SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7
SWISS: Q80ZE3
GeneID: 243958
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Siglecs (sialic acid binding Ig-like lectins) belong to the immunoglobulin superfamily. Siglec-G is the apparent ortholog of human Siglec-10. It is expressed by mature B cells, but significant levels of transcript were also detected in DC, myeloid cells, and to a lesser extent, T cells. Mature Siglec-G consists of a 526 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 124 aa cytoplasmic domain. Siglec-G is a member of the CD33-related Siglec family in the mouse, and is involved in negative regulation of B-cell antigen receptor signaling and specifically acts on B1 cells to inhibit Ca2+ signaling, cellular expansion and antibody secretion.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only