Recombinant Mouse Siglec-15/CD33L3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01290-10, RP01290-20, RP01290-50, RP01290-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg24-Thr262) of mouse Siglec-15/CD33L3 (Accession #NP_001094508.1) fused with a Fc tag at the C-terminus.
Alternate Names: sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15, sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15
SWISS: A7E1W8
GeneID: 620235
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTST
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only