ABclonal
Recombinant Mouse Siglec-3/CD33 Protein - RP01499
Recombinant Mouse Siglec-3/CD33 Protein - RP01499
Couldn't load pickup availability
Recombinant Mouse Siglec-3/CD33 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01499-10, RP01499-20, RP01499-50, RP01499-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Siglec-3/CD33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp18-Glu240) of mouse Siglec3/CD33 (Accession #NP_001104528.1) fused with a 6×His tag at the C-terminus.
Alternate Names: p67, Siglec-3, SIGLEC3, CD33
SWISS: Q63994-1
GeneID: 12489
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Myeloid cell surface antigen CD33 also known as Sialic acid binding Ig-like lectin 3, CD33 antigen or Siglec-3, is a member of the immunoglobulin superfamily and SIGLEC (sialic acid binding Ig-like lectin) family. This Single-pass type I membrane protein contains 1 Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. CD33/Siglec-3 induces apoptosis in acute myeloid leukemia (in vitro). CD33/Siglec-3 can function as a sialic acid-dependent cell adhesion molecule and that binding can be modulated by endogenous sialoglycoconjugates when CD33 is expressed in a plasma membrane.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMRE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
