Skip to product information
1 of 1

ABclonal

Recombinant Mouse Siglec-3/CD33 Protein - RP01499

Recombinant Mouse Siglec-3/CD33 Protein - RP01499

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Siglec-3/CD33 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01499-10, RP01499-20, RP01499-50, RP01499-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Siglec-3/CD33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp18-Glu240) of mouse Siglec3/CD33 (Accession #NP_001104528.1) fused with a 6×His tag at the C-terminus.

Alternate Names: p67, Siglec-3, SIGLEC3, CD33

SWISS: Q63994-1

GeneID: 12489

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Myeloid cell surface antigen CD33 also known as Sialic acid binding Ig-like lectin 3, CD33 antigen or Siglec-3, is a member of the immunoglobulin superfamily and SIGLEC (sialic acid binding Ig-like lectin) family. This Single-pass type I membrane protein contains 1 Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. CD33/Siglec-3 induces apoptosis in acute myeloid leukemia (in vitro). CD33/Siglec-3 can function as a sialic acid-dependent cell adhesion molecule and that binding can be modulated by endogenous sialoglycoconjugates when CD33 is expressed in a plasma membrane.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMRE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details