ABclonal
Recombinant Mouse SIRP-alpha/CD172a Protein - RP01580
Recombinant Mouse SIRP-alpha/CD172a Protein - RP01580
Couldn't load pickup availability
Recombinant Mouse SIRP-alpha/CD172a Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01580-10, RP01580-20, RP01580-50, RP01580-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse SIRP-alpha/CD172a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys32-Asn373) of mouse SIRP-alpha/CD172a (Accession #NP_001277948.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD172a, BIT, MFR, MYD1, MYD-1, P84, PTPNS1, SHP substrate 1, SHPS1, SHPS-1, SHPS1CD172A, SIRP alpha, SIRPA, Sirp-alpha-1, SIRPalpha2, Sirp-alpha-2, Sirp-alpha-3, SIRPA
SWISS: P97797
GeneID: 19261
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadly expressed transmembrane protein CD47 also called the "don′t eat me" signal.Cancer cells highly expressed CD47 that activate SIRP α and inhibit macrophage-mediated destruction.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
