Skip to product information
1 of 1

ABclonal

Recombinant Mouse Sonic hedgehog protein N-product/SHH Protein - RP01561

Recombinant Mouse Sonic hedgehog protein N-product/SHH Protein - RP01561

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Sonic hedgehog protein N-product/SHH Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01561-10, RP01561-20, RP01561-50, RP01561-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Sonic hedgehog protein N-product/SHH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gly198) of mouse Sonic hedgehog protein N-product/SHH (Accession #NP_033196.1) fused with a 6×His tag at the C-terminus.

Alternate Names: 9530036O11Rik, Dsh, Hhg1, Hx, Hxl3, M100081, SHH

SWISS: Q62226

GeneID: 20423

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: ACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details