Skip to product information
1 of 1

ABclonal

Recombinant Mouse TFPI Protein - RP01667

Recombinant Mouse TFPI Protein - RP01667

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TFPI Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01667-10, RP01667-20, RP01667-50, RP01667-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TFPI Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 29-Asn306) of mouse TFPI (Accession #NP_035706.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: EPI; LACI; A630013F22Rik; TFPI

SWISS: O54819

GeneID: 21788

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tissue factor pathway inhibitor (TFPI) is the natural inhibitor of TF coagulant and signaling activities. It is a Kunitz-type serine proteinase inhibitor that down-regulates tissue factor-initiated blood coagulation.

Bio-Activity: Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2(RD,Catalog # ES002). The IC50 value is <0.26 nM, as measured under the described conditions.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVKIQRRKAPFVKVVYESIN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details