ABclonal
Recombinant Mouse TFPI Protein - RP01667
Recombinant Mouse TFPI Protein - RP01667
Couldn't load pickup availability
Recombinant Mouse TFPI Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01667-10, RP01667-20, RP01667-50, RP01667-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse TFPI Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 29-Asn306) of mouse TFPI (Accession #NP_035706.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: EPI; LACI; A630013F22Rik; TFPI
SWISS: O54819
GeneID: 21788
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Tissue factor pathway inhibitor (TFPI) is the natural inhibitor of TF coagulant and signaling activities. It is a Kunitz-type serine proteinase inhibitor that down-regulates tissue factor-initiated blood coagulation.
Bio-Activity: Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2(RD,Catalog # ES002). The IC50 value is <0.26 nM, as measured under the described conditions.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVKIQRRKAPFVKVVYESIN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
