Skip to product information
1 of 1

ABclonal

Recombinant Mouse TGF-alpha Protein - RP01846

Recombinant Mouse TGF-alpha Protein - RP01846

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TGF-alpha Protein

Sizes: 10ug, 20ug

Catalogue Number: RP01846-10, RP01846-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TGF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala38-Ala88) of Mouse TGF-alpha/TGFA (Accession #NP_112476.1) fused with a hFc tag at the C-terminus.

Alternate Names: Protransforming growth factor alpha, Cleaved into: Transforming growth factor alpha, TGF-alpha, EGF-like TGF, ETGF, TGF type 1, Tgfa

SWISS: P48030

GeneID: 21802

Species: Mouse

Purity: ≥ 85% as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Transforming growth factor alpha (TGF-α) is a protein that in humans is encoded by the TGFA gene. TGF-alpha is a member of the EGF family of cytokines that are synthesized as transmembrane precursors and are characterized by the presence of one or several EGF structural units in their extracellular domain. Expression of TGF-alpha is widespread in tumors and transformed cells. TGF-alpha is also expressed in normal tissues during embryogenesis and in adult tissues, including pituitary, brain, keratinocytes, and macrophages.TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.

Bio-Activity: Measured in a cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED50 for this effect is 0.43-1.72 ng/mL, corresponding to a specific activity of 15.81×10^5 ~2.33×10^6 units/mg.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details