ABclonal
Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein - RP00649
Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein - RP00649
Couldn't load pickup availability
Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00649-10, RP00649-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr20-Glu140) of mouse Thymic stromal lymphopoietin/TSLP (Accession #Q9JIE6) fused with an Fc tag at the C-terminus.
Alternate Names: Thymic stromal lymphopoietin; Thymic stroma-derived lymphopoietin; Tslp
SWISS: Q9JIE6
GeneID: 53603
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Thymic stromal lymphopoietin (TSLP) is a protein belonging to the cytokine family, contains 140 amino acids. Itis known to play an important role in the maturation of T cell populations through activation of antigenpresenting cells. TSLP induces the release of T-cell-attracting chemokines from monocytes and, in particular,enhances the maturation of CD11c+ dendritic cells. It can induce allergic inflammation by directly activatingmast cells. TSLP is produced mainly by non-hematopoietic cells such as fibroblasts, epithelial cells and differenttypes of stromal or stromal-like cells. These cells are located in regions where TSLP activity is required.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
