ABclonal
Recombinant Mouse TIM-3/HAVCR2/CD366 Protein - RP01152
Recombinant Mouse TIM-3/HAVCR2/CD366 Protein - RP01152
Couldn't load pickup availability
Recombinant Mouse TIM-3/HAVCR2/CD366 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01152-10, RP01152-20, RP01152-50, RP01152-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse TIM-3/HAVCR2/CD366 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Arg191) of mouse TIM-3 (Accession #NP_599011.2) fused with a 6×His tag at the C-terminus.
Alternate Names: Tim, TIM-, Tim3, Timd, TIM-3, Timd3, HAVCR2
SWISS: Q8VIM0
GeneID: 171285
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: HAVCR2 also known as TIM3(T cell immunoglobulin and mucin domain-3) is belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance. Its binding to Galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse TIM-3 at 2 μg/mL (100 μL/well) can bind Anti-TIM-3 antibody with a linear range of 0.5-1.5 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
