Skip to product information
1 of 1

ABclonal

Recombinant Mouse TNF-alpha Protein - RP01071

Recombinant Mouse TNF-alpha Protein - RP01071

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TNF-alpha Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01071-10, RP01071-20, RP01071-50, RP01071-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of mouse TNF-alpha (Accession #NP_038721.1) fused with a 6×His tag at the C-terminus.

Alternate Names: DIF, Tnfa, TNF-a, TNFSF2, Tnlg1f, Tnfsf1a, TNFalpha, TNF-alpha, TNF

SWISS: P06804

GeneID: 21926

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Immobilized recombinant Mouse TNFα at 2 μg/mL (100 μL/well) can bind Human TNFRSF1A with a linear range of 4-53 ng/mL.│2.Immobilized Recombinant Mouse TNF-α at 2 μg/mL (100 μL/well) can bind Mouse TNFRSF1B with a linear range of 0.02-0.77 ng/mL.│3.Recombinant Mouse TNF-alpha induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is typically 3.55-14.2 pg/mL, corresponding to a specific activity of 7.04×107~2.82×108 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details