Skip to product information
1 of 1

ABclonal

Recombinant Mouse TNFRSF18/GITR/CD357 Protein - RP02184

Recombinant Mouse TNFRSF18/GITR/CD357 Protein - RP02184

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TNFRSF18/GITR/CD357 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02184-10, RP02184-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFRSF18/GITR/CD357 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ser22-His153) of mouse GITR (Accession #O35714) fused with an Fc, 6xHis tag at the C-terminus.

Alternate Names: AITR, Gitr, Tnfrsf18

SWISS: O35714

GeneID: 21936

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tumor necrosis factor receptor superfamily member 18(Gitr) contains 3 TNFR-Cys repeats and it have four isforms.IsformA 、 isformB and isformC is single-pass type I membrane protein and isformD is a secreted protein. The protein is the receptor for TNFSF18.It seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. It mediated NF-kappa-B activation via the TRAF2/NIK pathway.It binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 and binds through its C-terminus to SIVA1/SIVA.It preferentially expressed in activated T lymphocytes and up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.

Source: HEK293 cells

Tag: C-Fc&His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details