Skip to product information
1 of 1

ABclonal

Recombinant Mouse TNFRSF4/OX40/CD134 Protein - RP01324

Recombinant Mouse TNFRSF4/OX40/CD134 Protein - RP01324

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TNFRSF4/OX40/CD134 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01324-10, RP01324-20, RP01324-50, RP01324-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFRSF4/OX40/CD134 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val20-Pro211) of Mouse TNFRSF4 (Accession #NP_035789.1) fused with an 6×His tag at the C-terminus.

Alternate Names: TNFRSF4, OX40, CD134, OX40L receptor, ACT35, TXGP1L, TNFRSF4

SWISS: P47741

GeneID: 22163

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: OX40 (CD134) and its binding partner, OX40L (CD252), are members of the tumor necrosis factor receptor/tumor necrosis factor superfamily, is known to break an existing state of tolerance in malignancies, leading to a reactivation of antitumor immunity. The interaction between OX40 and OX40L plays an important role in antigen-specific T-cell expansion and survival. OX40 and OX40L also regulate cytokine production from T cells, antigen-presenting cells, natural killer cells, and natural killer T cells, and modulate cytokine receptor signaling.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQ CTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQAC KPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSEL PSPPTLVTPEGP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details