Skip to product information
1 of 1

ABclonal

Recombinant Mouse TNFRSF5/CD40 Protein - RP01325

Recombinant Mouse TNFRSF5/CD40 Protein - RP01325

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TNFRSF5/CD40 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01325-10, RP01325-20, RP01325-50, RP01325-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFRSF5/CD40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Arg193) of Mouse CD40 (Accession #NP_035741.2) fused with an 6×His tag at the C-terminus.

Alternate Names: CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50, CD40

SWISS: P27512

GeneID: 21939

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins.plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation.CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines.Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules,which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Defects in CD40 result in hyper-IgM immunodeficiency type 3 (HIGM3).

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQ HRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETT DTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details