Skip to product information
1 of 1

ABclonal

Recombinant Mouse TNFRSF6/FAS/CD95 Protein - RP00737

Recombinant Mouse TNFRSF6/FAS/CD95 Protein - RP00737

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TNFRSF6/FAS/CD95 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP00737-10, RP00737-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFRSF6/FAS/CD95 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln22-Arg169) of Mouse TNFRSF6/FAS/CD95 (Accession #P25446 ) fused with a 6×His tag at the C-terminus.

Alternate Names: Tumor necrosis factor receptor superfamily member 6; Apo-1 antigen; Apoptosis-mediatingsurface antigen FAS; FASLG receptor; CD95; Fas; TNFRSF6

SWISS: P25446

GeneID: 14102

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Mouse Apoptosis-mediating surface antigen FAS (Fas) belongs to the death receptor subfamily of the TNFreceptor superfamily and is designated TNFRSF6. Mouse Fas contains 1 death domain and 3 TNFR-Cys repeats.It detected in various tissues including thymus, liver, lung, heart, and adult ovary. As a receptor forTNFSF6/FASLG, The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequentcascade of caspases mediating apoptosis. FAS-mediated apoptosis may have a role in the induction ofperipheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.

Source: HEK293 cells

Tag: C-6×His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details