WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein - RP01552

Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein - RP01552

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01552-10, RP01552-20, RP01552-50, RP01552-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val24-Leu211) of mouse TNFRSF9/4-1BB/CD137 (Accession #NP_001070976.1) fused with a 6×His tag at the C-terminus.

Alternate Names: 4-1BB , CD137 , CDw137 , ILA, TNFRSF9, 4-1BB , CD137 , CDw137 , ILA, TNFRSF9

SWISS: Q8R037

GeneID: 21942

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly on activated CD4+ and CD8+ T cells, and binds to a high-affinity ligand (4-1BBL) expressed on several antigen-presenting cells such as macrophages and activated B cells. Upon ligand binding, 4-1BB is associated with the tumor necrosis factor receptor–associated factors (TRAFs), the adaptor protein which mediates downstream signaling events including the activation of NF-kappaB and cytokine production. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T-cell activation and growth, as well as monocyte proliferation and B-cell survival, and plays an important role in the amplification of T cell-mediated immune responses.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only