Skip to product information
1 of 1

ABclonal

Recombinant Mouse TNFSF13/APRIL/CD256 Protein - RP01753

Recombinant Mouse TNFSF13/APRIL/CD256 Protein - RP01753

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TNFSF13/APRIL/CD256 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01753-10, RP01753-20, RP01753-50, RP01753-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFSF13/APRIL/CD256 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys104-Leu241) of mouse TNFSF13/APRIL/CD256 (Accession #NP_001152977.1) fused with a hFc tag at the C-terminus.

Alternate Names: April; Tall2; Trdl1; Tnlg7b; 2310026N09Rik; TNFSF13; CD256

SWISS: Q9D777

GeneID: 69583

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: TNFSF13 is a member of the tumor necrosis factor (TNF) ligand family. It is a ligand for TNFRSF17/BCMA. TNFSF13 is lowly expressed in normal tissues, but is elevated in several types of tumors and transformed cell lines. It is important for B cell development. TNFSF13 may also play a role in T-independent type II antigen responses and T cell survival, and induce proliferation/survival of non lymphoid cells. It exists as a functional homotrimer. It can bind to two cell surface receptors, BCMA and TACI, which it shares with BAFF to exert downstream T- and B-cell regulatory effects. TNFSF13 also has been demonstrated to bind to proteoglycans on the cell surface.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details