ABclonal
Recombinant Mouse TNFSF4/OX40 ligand/CD252 Protein - RP00713
Recombinant Mouse TNFSF4/OX40 ligand/CD252 Protein - RP00713
Couldn't load pickup availability
Recombinant Mouse TNFSF4/OX40 ligand/CD252 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00713-10, RP00713-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse TNFSF4/OX40 Ligand Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ser51-Leu198) of mouse TNFSF4/OX40 Ligand (Accession #P43488) fused with an 8×His tag at the N-terminus.
Alternate Names: Tumor necrosis factor ligand superfamily member 4, TNFSF4, CD134 ligand, CD134L, CD252, CD252 antigen, OX40 antigen ligand, OX40 ligand, OX40L, TAX transcriptionally-activatedglycoprotein 1, tumor necrosis factor (ligand) superfamily, member 4, Tnfsf4
SWISS: P43488
GeneID: 22164
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptorsuperfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival andfor the generation of memory T cells from activated effector T cells. OX40L – OX40 co-stimulation leads toactivation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong thesurvival of effector CD4+Th cells as well as contributes to generation of memory T cells.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
