Skip to product information
1 of 1

ABclonal

Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein - RP01734

Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein - RP01734

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01734-10, RP01734-20, RP01734-50, RP01734-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly115-Leu260) of mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG (Accession #NP_035746.2) fused with and a 6×His tag at the N-terminus.

Alternate Names: IGM; IMD3; Ly62; TRAP; gp39; CD154; Cd40l; HIGM1; Ly-62; T-BAM; CD40-L; Tnfsf5; Tnlg8b; CD40LG

SWISS: P27548

GeneID: 21947

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD154, also known as CD40 ligand or CD40L, is a member of the TNF superfamily. While CD154 was originally found on T cell surface, its expression has since been found on a wide variety of cells, including platelets, mast cells, macrophages and NK cells. CD154's ability is achieved through binding to the CD40 on antigen-presenting cells (APC). In the macrophage cells, the primary signal for activation is IFN-γ from Th1 type CD4 T cells. The secondary signal is CD40L on the T cell, which interacting with the CD40 molecules, helping increase the level of activation.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse CD40L (Catalog: RP01734) at 5 μg/mL (100 μL/well) can bind Human CD40 (Catalog: RP01218) with a linear range of 0.005-1 μg/mL.

Source: HEK293 cells

Tag: N-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details