WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein - RP01916

Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein - RP01916

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01916-10, RP01916-20, RP01916-50, RP01916-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFSF8/CD30 Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser103-ASP239) of Mouse TNFSF8/CD30 Ligand (Accession #NP_033429.1) fused with a His tag at the N-terminus.

Alternate Names: CD153 antigen; CD153; CD30 antigen ligand; CD30 Ligand; CD30L; CD30-L; CD30LCD30 ligand; CD30LGMGC138144; TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand superfamily member 8

SWISS: P32972

GeneID: 21949

Species: Mouse

Purity: ≥ 85% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD30 Ligand (CD30L)/TNFSF8 is a type II membrane protein belonging to the TNF superfamily. CD30L is expressed on the cell surface of activated T cells, B cells, and monocytes. The protein is also constitutively expressed on granulocytes and medullary thymic epithelial cells. The specific receptor for CD30L is CD30/TNFRSF8, a type I transmembrane glycoprotein belonging to the TNF receptor superfamily. CD30 was originally identified as a cell surface antigen of Hodgkin's and Reed-Sternberg cells using the monoclonal antibody Ki-1. CD30 is also expressed on different non-Hodgkin's lymphomas, virus-infected T and B cells, and on normal T and B cells after activation. Among T cells, CD30 is preferentially expressed on a subset of T cells producing Th2-type cytokines and on CD4+/CD8+ thymocytes that coexpress CD45RO and IL-4 receptor. CD30 ligation by CD30L mediates pleiotropic effects including cell proliferation, activation, differentiation and cell death by apoptosis. CD30 can act as a costimulatory molecule in thymic negative selection and may also play a critical role in the pathophysiology of Hodgkin's disease and other CD30+ lymphomas.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only