Recombinant Mouse TREM2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01558-10, RP01558-20, RP01558-50, RP01558-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu19-Ser171) of mouse TREM-2 (Accession #NP_112544.1) fused with a 6×His tag at the C-terminus.
Alternate Names: TREM-2, Trem2a, Trem2b, Trem2c, TREM2
SWISS: Q99NH8-1
GeneID: 83433
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Triggering Receptor Expressed on Myeloid cells 2 (TREM2)is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM2 consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. Soluble forms of the TREM2 ECD are generated by alternative splicing or proteolytic cleavage, and the cytoplasmic domain can be liberated by gamma-Secretase mediated intramembrane cleavage. A positively charged lysine within the transmembrane segment allows association with the signal adapter protein, DAP12 and inhibition of macrophage activation. TREM2 is expressed on macrophages, immature myeloid dendritic cells, osteoclasts, microglia, and adipocytes.It promotes the differentiation and function of osteoclasts, the production of inflammatory cytokines by adipocytes, insulin resistance, and the phagocytic clearance of bacteria
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse TREM-2 Protein at 1 μg/mL (100 μL/well) can bind TREM-2 Rabbit pAb with a linear range of 0.06-11.7 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS
Endotoxin: Please contact us for more information.
Research Use Only