WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Tyrosine-protein kinase receptor UFO/Axl Protein - RP01571

Recombinant Mouse Tyrosine-protein kinase receptor UFO/Axl Protein - RP01571

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Tyrosine-protein kinase receptor UFO/Axl Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01571-10, RP01571-20, RP01571-50, RP01571-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Tyrosine-protein kinase receptor UFO/Axl Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-Trp445) of mouse Tyrosine-protein kinase receptor UFO/Axl (Accession #NP_033491.2) fused with a hFc tag at the C-terminus.

Alternate Names: ARK Protein, JTK11 Protein, Tyro7 Protein, UFO Protein, AXL, ARK Protein, JTK11 Protein, Tyro7 Protein, UFO Protein, AXL

SWISS: Q00993

GeneID: 26362

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Axl receptor tyrosine kinase, together with Tyro3 and Mer, constitute the TAM family of receptor tyrosine kinases. In the nervous system, Axl and its ligand Growth-arrest-specific protein 6 (Gas6) are expressed on multiple cell types. Axl functions in dampening the immune response, regulating cytokine secretion, clearing apoptotic cells and debris, and maintaining cell survival. Axl is upregulated in various disease states, such as in the cuprizone toxicity-induced model of demyelination and in multiple sclerosis (MS) lesions, suggesting that it plays a role in disease pathogenesis. Axl expression correlates with poor prognosis in several cancers. Axl mediates multiple oncogenic phenotypes and activation of these RTKs constitutes a mechanism of chemoresistance in a variety of solid tumors. Axl contributes to cell survival, migration, invasion, metastasis and chemosensitivity justify further investigation of Axl as novel therapeutic targets in cancer. The receptor tyrosine kinase AXL is thought to play a role in metastasis. The soluble AXL receptor as a therapeutic candidate agent for treatment of metastatic ovarian cancer. GAS6/AXL targeting as an effective strategy for inhibition of metastatic tumor progression in vivo.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human Gas6 at 2 μg/mL (100 μL/well) can bind Mouse Axl with a linear range of 0.02-2 ng/mL.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: AHKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWW

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only