Recombinant Mouse VEGF-D/FIGF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01778-10, RP01778-20, RP01778-50, RP01778-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse VEGF-D/FIGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe98-Ser206) of Mouse VEGF-D/FIGF (Accession #NP_001295418.1) fused with a His tag at the C-terminus.
Alternate Names: Vegfd, Figf, Vascular endothelial growth factor D, VEGF-D, c-Fos-induced growth factor, FIGF
SWISS: P97946
GeneID: 14205
Species: Mouse
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Vascular endothelia growth factor D (VEGF-D), also known as c-fos-induced growth factor (FIGF), is a secreted glycoprotein of the VEGF/PDGF family. VEGFs regulate angiogenesis and lymphangiogenesis during development and tumor growth, and are characterized by eight conserved cysteine residues that form a cysteine-knot structure. VEGF-C and VEGF-D, which share 23% amino acid (aa) sequence identity, are uniquely expressed as preproproteins that contain long N- and C-terminal propeptide extensions around the VEGF homology domain (VHD). Proteolytic processing of either 358 aa or 326 aa splice forms of mouse VEGF-D preproprotein creates a secreted proprotein. Further processing by extracellular serine proteases, such as plasmin or furin-like proprotein convertases, forms mature VEGF-D consisting of non-covalently linked 42 kDa homodimers of the 117 aa VHD. Mature mouse VEGF-D shares 94%, 99%, 93%, 91% and 89% aa identity with the VHD of human, rat, equine, canine and bovine VEGF-D, respectively. It is expressed in adult lung, heart, muscle, and small intestine, and is most abundantly expressed in fetal lungs and skin. Mouse and human VEGF-D are ligands for VEGF receptor 3 (VEGF-R3, also called Flt-4) that are active across species and show enhanced affinity when processed. Unlike human VEGF-D, which is also a ligand for VEGF-R2 (also called Flk-1 or KDR), mouse VEGF-D does not bind to VEGF-R2. VEGF-R3 is strongly expressed in lymphatic endothelial cells and is essential for regulation of the growth and differentiation of lymphatic endothelium. While VEGF-C is the critical ligand for VEGF-R3 during embryonic lymphatic development, VEGF-D is most active in neonatal lymphatic maturation and bone growth. Both promote tumor lymphangiogenesis. Consonant with their activity on VEGF receptors, binding of VEGF-C and VEGF-D to neuropilins contributes to VEGF-R3 signaling in lymphangiogenesis, while binding to integrin alpha 9 beta 1 mediates endothelial cell adhesion and migration.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse VEGFD(Catalog: RP01778) at 5 μg/mL (100 μL/well) can bind Human VEGFR-3/FLT-4 (Catalog: RP00123) with a linear range of 0.5-67.73 ng/mL.
Source: HEK293 cells
Tag: C-6*His
Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: YDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only