WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Murine NOGGIN (rMuNOGGIN ) - PR2032

Recombinant Murine NOGGIN (rMuNOGGIN ) - PR2032

Regular price
$260.23
Regular price
Sale price
$260.23
Unit price
per 
Availability
Sold out

Recombinant Murine NOGGIN (rMuNOGGIN )

Catalogue Numbers: PR2032-5, PR2032-20

Sizes: 5µg, 20µg

Source: Escherichia coli

Molecular Weight: Approximately 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.

Purity: >95% by SDS-PAGE and HPLC analyses.

Biological Activity: Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 1.0-2.0 ng/ml of Noggin, corresponding to a Specific Activity of >5 x 105 IU/mg.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.

AA Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSV PEGMVCKPSK SVHLt VLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC

Endotoxin: Less than 1EU/mg of rMuNOGGIN as determined by LAL method.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

Description: Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.