BioWorld
Recombinant NGFR, Human - BK0325
Recombinant NGFR, Human - BK0325
Couldn't load pickup availability
Recombinant NGFR, Human
Catalogue Numbers: BK0325-10, BK0325-50
Sizes: 10μg, 50μg
Source: HEK 293
Molecular Weight: 32-60 kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE.
Biological Activity: ED50 < 0.4 μg /ml, measured in a neutrolization assay using TF-1 cells in the presence of 10ng/ml human b-NGF.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: KEACPTGLYTHSGECCKACNLGEGVAQPCGANQt VCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCR
CAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNt VCEECPDGTYSDEANHVDPCLPCt VCEDTERQLRECTRWADAEC
EEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASt VAGVVTt VMGSSQPVVTRGTTDN
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant human NGF Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human NGF Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: NGF Receptor, also known as Gp80-LNGFR, p75 ICD, CD271 and TNFRSF16, is a type I transmembrane protein belonging to the TNF receptor family. It is expressed by both neuronal and non-neuronal cells. Signaling through NGF Receptor has been shown to regulate gene expression, cell migration and death. A truncated NGF Receptor containing only the extracellular domain has been detected in plasma, amniotic fluid and urine, and acts as a potent NGF antagonist.