Skip to product information
1 of 1

BioWorld

Recombinant OSM, Mouse (HEK293-expressed) - BK0326

Recombinant OSM, Mouse (HEK293-expressed) - BK0326

Regular price $375.54 CAD
Regular price Sale price $375.54 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant OSM, Mouse (HEK293-expre Ssed)

Catalogue Numbers: BK0326-10, BK0326-50

Sizes: 10μg, 50μg

Source: HEK 293

Molecular Weight: 10-40 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE and HPLC.

Biological Activity: ED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSt VYTTLDRV
LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY
HRFMGSVGRVFREWDDGSTRSRR

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.

View full details