Skip to product information
1 of 1

BioWorld

Recombinant PDGF-CC, Human - BK0327

Recombinant PDGF-CC, Human - BK0327

Regular price $217.41 CAD
Regular price Sale price $217.41 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant PDGF-CC, Human

Catalogue Numbers: BK0327-10, BK0327-50

Sizes: 10μg, 50μg

Source: HEK 293

Molecular Weight: 15~19 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK
TGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB).

View full details