Skip to product information
1 of 1

BioWorld

Recombinant PDGF-DD, Human - BK0281

Recombinant PDGF-DD, Human - BK0281

Regular price $256.94 CAD
Regular price Sale price $256.94 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant PDGF-DD, Human

Catalogue Numbers: BK0281-10, BK0281-50

Sizes: 10μg, 50μg

Source: CHO

Molecular Weight: 19-21 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGt VNWRSCTCNSGKt VKKYHE
VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.

View full details