Skip to product information
1 of 1

ABclonal

Recombinant Rat ALK-1/ACVRL1 Protein - RP01925

Recombinant Rat ALK-1/ACVRL1 Protein - RP01925

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat ALK-1/ACVRL1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01925-10, RP01925-20, RP01925-50, RP01925-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Recombinant Rat ALK-1/ACVRL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys21-Ala118) of Rat ALK-1/ACVRL1 (Accession #NP_071886.1) fused with a hFc tag at the C-terminus.

Alternate Names: Acvrl1, Acvrlk1, Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, TGF-B superfamily receptor type I, TSR-I

SWISS: P80203

GeneID: 25237

Species: Rat

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: ALK-1/ACVRL1,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat ALK-1(Catalog #RP01925) at 4 μg/mL (100 μL/well) can bind Human ACVR2B (Catalog #RP00153) with a linear range of 20-989.42 ng/mL.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: KGDLVKPSRGQLVNCTCENPHCKRPICQGAWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFVNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDA

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details