Skip to product information
1 of 1

ABclonal

Recombinant Rat c-Kit ligand/KITLG/SCF Protein - RP01794

Recombinant Rat c-Kit ligand/KITLG/SCF Protein - RP01794

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat c-Kit ligand/KITLG/SCF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01794-10, RP01794-20, RP01794-50, RP01794-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat c-Kit ligand/KITLG/SCF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Ala189) of rat c-Kit ligand/SCF/KITLG (Accession #NP_068615.1) fused with 6×His tag at the C-terminus.

Alternate Names: Mgf; SCF; Kitl; c-Kit ligand

SWISS: P21581-1

GeneID: 60427

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Similar to Kit ligand precursor (C-kit ligand), also known as Stem cell factor (SCF), Mast cell growth factor (MGF), or Hematopoietic growth factor KL. SCF/C-kit ligand is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. SCF/C-kit ligand stimulates the proliferation of mast cells. This protein can augment the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. It may act synergistically with other cytokines, probably interleukins SCF/C-kit ligand is the ligand for the tyrosine kinase receptor c-kit, which is expressed on both primitive and mature hematopoietic progenitor cells. In vitro, SCF/C-kit ligand synergizes with other growth factors, such as granulocyte colony-stimulating factor (G-CSF), granulocyte-macrophage colony-stimulating factor, and interleukin-3 to stimulate the proliferation and differentiation of cells of the lymphoid, myeloid, erythroid, and megakaryocytic lineages. In vivo, SCF/C-kit also synergizes with other growth factors and has been shown to enhance the mobilization of peripheral blood progenitor cells in combination with G-CSF. In phase I/II clinical studies administration of the combination of SCF and G-CSF resulted in a two- to threefold increase in cells that express the CD34 antigen compared with G-CSF alone.

Bio-Activity: Measured in a cell proliferation assay using MC/9‑2 mouse mast cells.The ED50 for this effect is 9.95-39.78 ng/mL, corresponding to a specific activity of 2.51×10^4 ~ 1.01× 10 ^5 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details