Skip to product information
1 of 1

ABclonal

Recombinant Rat CCL2/MCP-1 Protein - RP01073

Recombinant Rat CCL2/MCP-1 Protein - RP01073

Regular price $252.00 CAD
Regular price Sale price $252.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat CCL2/MCP-1 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01073-20, RP01073-50, RP01073-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat CCL2/MCP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Asn148) of rat CCL2/JE/MCP-1 (Accession #NP_113718.1.) fused with a 6×His tag at the C-terminus.

Alternate Names: C-C motif chemokine ligand 2, CCL2, GDCF-2, HC11, HSMCR30, MCAF, Mcp1, MCP-1, SCYA2, SMC-CF, Ccl2/MCP1

SWISS: P14844

GeneID: 24770

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details