ABclonal
Recombinant Rat CD47 Protein - RP01669
Recombinant Rat CD47 Protein - RP01669
Couldn't load pickup availability
Recombinant Rat CD47 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01669-10, RP01669-20, RP01669-50, RP01669-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln 19 - Lys 140) of rat CD47 (Accession #NP_062068.1) fused with and a hFc tag at the C-terminus.
Alternate Names: Itgp; CD47
SWISS: P97829
GeneID: 29364
Species: Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD47 contains 1 Ig-like V-type (immunoglobulin-like) domain and is a receptor for the C-terminal cell binding domain of thrombospondin. It may play a role in membrane transport and signal transduction. CD47 is also a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. It is very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. CD47 may play a role in membrane transport and/or integrin dependent signal transduction. It may prevent premature elimination of red blood cells. It also may be involved in membrane permeability changes induced following virus infection. By acting as an adhesion receptor for THBS1 on platelets, CD47 plays a role in both cell adhesion and in the modulation of integrins. It also plays an important role in memory formation and synaptic plasticity in the hippocampus.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human CD172a (Catalog: RP00285) at 2 μg/mL (100 μL/well) can bind Human CD47 (Catalog: RP01669) with a linear range of 19.5-3491.5ng/mL.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTNEK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
