Skip to product information
1 of 1

ABclonal

Recombinant Rat CNTF Protein - RP01671

Recombinant Rat CNTF Protein - RP01671

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat CNTF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01671-10, RP01671-20, RP01671-50, RP01671-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat CNTF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met200) of rat CNTF (Accession #NP_037298.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: CNTF

SWISS: P20294

GeneID: 25707

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Ciliary neurotrophic factor (CNTF) is a member of the cytokine family. It is a polypeptide hormone that has functions in promoting neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. Its actions appear to be restricted to the nervous system. Ciliary neurotrophic factor (CNTF) has biological effects through the activation of a multi-subunit receptor complex, consisting of an extracellular CNTF binding subunit (CNTFα) and two transmembrane signal transduction proteins: glycoprotein gp130 and LIF receptor. CNTF is considered as a potent survival factor of neurons and oligodendrocyteands may be relevant in reducing tissue destruction during inflammatory attacks. CNTF also is a survival factor for neurons of the peripheral sensory sympathetic and ciliary ganglia. It has been reported that CNTF could be an agent that has therapeutic potential and possibly induces differentiation of large multipolar ganglionic phenotype in a subset of progenitors.

Bio-Activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 14.08-56.34 ng/mL.

Source: E. coli

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MAFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details