Skip to product information
1 of 1

ABclonal

Recombinant Rat CSF-1/M-CSF Protein - RP01847

Recombinant Rat CSF-1/M-CSF Protein - RP01847

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat CSF-1/M-CSF Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01847-20, RP01847-50, RP01847-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat CSF-1/M-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ser255) of Rat CSF-1/M-CSF (Accession #NP_076471.3 ) fused with a His tag at the C-terminus.

Alternate Names: Macrophage colony-stimulating factor 1, CSF-1, MCSF, Proteoglycan macrophage colony-stimulating factor, PG-M-CSF, Cleaved into: Processed macrophage colony-stimulating factor 1, Macrophage colony-stimulating factor 1 43 kDa subunit, Csf1, Csfm

SWISS: Q8JZQ0

GeneID: 78965

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Macrophage colony-stimulating factor (M-CSF), also known as colony-stimulating factor-1 (CSF-1), is a hemopoietic growth factor that regulates the survival, proliferation, differentiation and function of the cells of the mononuclear phagocyte lineage. M-CSF is produced by a variety of cell types and acts both locally and humorally in an autocrine and paracrine manner. Through differential mRNA splicing and posttranslational proteolytic processing and modification, M-CSF is expressed in three biologically-active isoforms: a secreted glycoprotein; a secreted proteoglycan; and a membrane spanning cell-surface glycoprotein.

Bio-Activity: Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 5.63-22.51 ng/mL, corresponding to a specific activity of 4.44×10^4 ~1.78×10^5 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: PSSTWMGSRLLLVCLLVSRSVAEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPRS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details