WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat Erythropoietin/EPO Protein - RP01858

Recombinant Rat Erythropoietin/EPO Protein - RP01858

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Rat Erythropoietin/EPO Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01858-10, RP01858-20, RP01858-50, RP01858-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat Erythropoietin/EPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg192) of Rat Erythropoietin/EPO (Accession #NP_058697.1) fused with a His tag at the C-terminus.

Alternate Names: Erythropoietin, Epo

SWISS: P29676

GeneID: 24335

Species: Rat

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Erythropoietin (EPO), originally identified for its critical hormonal role in promoting erythrocyte survival and differentiation, is a member of the large and diverse cytokine superfamily. EPO and EPOR function as the primary mediators of a general protective response to tissue hypoxia, which acts to maintain adequate tissue oxygenation through adjustments of circulating red cell mass by using a hormonal feedback-control system involving the kidney and the bone marrow. EPO and EPORs are also expressed by other tissues and organs, including the brain and heart. EPO has also been shown to stimulate mitosis and signaling in astrocytes, endothelial cells, cardiomyoblasts, and cardiomyocytes maintained in vitro

Bio-Activity: Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 0.7-2.8 ng/mL, corresponding to a specific activity of 3.57×10^5 ~1.43×10^6 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only