ABclonal
Recombinant Rat FGF-2/bFGF Protein - RP01759
Recombinant Rat FGF-2/bFGF Protein - RP01759
Couldn't load pickup availability
Recombinant Rat FGF-2/bFGF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01759-10, RP01759-20, RP01759-50, RP01759-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala11-Ser154) of rat FGF-2/bFGF (Accession #NP_062178.1) fused with a 6×His tag at the C-terminus.
Alternate Names: bFGF; Fgf-2; Fgf2a; FGF2
SWISS: P13109
GeneID: 54250
Species: Rat
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: FGF basic is a member of the FGF family of at least 23 related mitogenic proteins which show 35-60% amino acid conservation. FGF acidic and basic, unlike the other members of the family, lack signal peptides and are apparently secreted by mechanisms other than the classical protein secretion pathway. FGF basic has been isolated from a number of sources, including neural tissue, pituitary, adrenal cortex, corpus luteum, and placenta. This factor contains four cysteine residues, but reduced FGF basic retains full biological activity, indicating that disulfide bonds are not required for this activity. bFGF is a critical component of human embryonic stem cell culture medium; the growth factor is necessary for the cells to remain in an undifferentiated state, although the mechanisms by which it does this are poorly defined. It has been demonstrated to induce gremlin expression which in turn is known to inhibit the induction of differentiation by bone morphogenetic proteins. It is necessary in mouse-feeder cell dependent culture systems, as well as in feeder and serum-free culture systems.
Source: E. coli
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
