Skip to product information
1 of 1

ABclonal

Recombinant Rat Follistatin/FST Protein - RP01893

Recombinant Rat Follistatin/FST Protein - RP01893

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat Follistatin/FST Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01893-10, RP01893-20, RP01893-50, RP01893-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat Follistatin/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Trp344) of Rat Follistatin/FST (Accession #NP_036693.1) fused with a His tag at the C-terminus.

Alternate Names: Fst, Follistatin, FS, Activin-binding protein

SWISS: P21674

GeneID: 24373

Species: Rat

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Enables heparan sulfate proteoglycan binding activity. Predicted to be involved in hematopoietic progenitor cell differentiation; negative regulation of transcription by RNA polymerase II; and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including animal organ development; keratinocyte proliferation; and positive regulation of hair follicle development. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin).

Bio-Activity: Measured by its ability to neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED50 for this effect is 23.68-94.70 ng/mL, corresponding to a specific activity of 1.06×10^4 ~4.22×10^4 units/mg in the prese

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details