ABclonal
Recombinant Rat Follistatin/FST Protein - RP01893
Recombinant Rat Follistatin/FST Protein - RP01893
Couldn't load pickup availability
Recombinant Rat Follistatin/FST Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01893-10, RP01893-20, RP01893-50, RP01893-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat Follistatin/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Trp344) of Rat Follistatin/FST (Accession #NP_036693.1) fused with a His tag at the C-terminus.
Alternate Names: Fst, Follistatin, FS, Activin-binding protein
SWISS: P21674
GeneID: 24373
Species: Rat
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Enables heparan sulfate proteoglycan binding activity. Predicted to be involved in hematopoietic progenitor cell differentiation; negative regulation of transcription by RNA polymerase II; and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including animal organ development; keratinocyte proliferation; and positive regulation of hair follicle development. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin).
Bio-Activity: Measured by its ability to neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED50 for this effect is 23.68-94.70 ng/mL, corresponding to a specific activity of 1.06×10^4 ~4.22×10^4 units/mg in the prese
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
