ABclonal
Recombinant Rat IFN-gamma Protein - RP01075
Recombinant Rat IFN-gamma Protein - RP01075
Couldn't load pickup availability
Recombinant Rat IFN-gamma Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01075-10, RP01075-20, RP01075-50, RP01075-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat Interferon Gamma (Accession #NP_620235.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: IFN-gamma, Interferon Gamma, IFNG
SWISS: P01581
GeneID: 25712
Species: Rat
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IFN-gamma R1 at 3 μg/mL (100 μL/well) can bind recombinant Rat IFNG, the EC50 of Rat IFNG is 1 μg/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized recombinant Mouse IFNGR1 at 0.2 μg/mL (100 μL/well) can bind recombinant Rat IFNG, the EC50 of Rat IFNG is 1.94 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
