Skip to product information
1 of 1

ABclonal

Recombinant Rat IFN-gamma Protein - RP01739

Recombinant Rat IFN-gamma Protein - RP01739

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat IFN-gamma Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01739-10, RP01739-20, RP01739-50, RP01739-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat IFN-gamma (Accession #NP_620235.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: If2f; IFNG2; IFNG; IFN-gamma

SWISS: P01581

GeneID: 25712

Species: Rat

Purity: ≥ 85% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IFNGR1 (Catalog #RP00200) at 2 μg/mL (100 μL/well) can bind Rat IFN-γ(Catalog #RP01739) with a linear range of 0.06-2.00 μg/mL.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details