Skip to product information
1 of 1

ABclonal

Recombinant Rat IL-7 Protein - RP01721

Recombinant Rat IL-7 Protein - RP01721

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat IL-7 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01721-10, RP01721-20, RP01721-50, RP01721-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-Ile154) of rat IL-7 (Accession #NP_037242.2) fused with and a 6×His tag at the C-terminus.

Alternate Names: IL-7, Interleukin-7; IL7

SWISS: Q91Y32

GeneID: 25647

Species: Rat

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. It is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCR?) during early T cell development. IL7 can be produced locally by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes.

Bio-Activity: Measured in a cell proliferation assay using murine 2E8 cells. The ED50 for this effect is 0.9-3.6 ng/mL, corresponding to a specific activity of 2.9×10^5 ~1.2×10^6 units/mg.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details