Recombinant Rat Lipocalin-2/NGAL/LCN2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01225-10, RP01225-20, RP01225-50, RP01225-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Asn198) of rat Lipocalin-2/NGAL (Accession #NP_570097.1.) fused with a 6×His tag at the C-terminus.
Alternate Names: NGAL, LCN2, Lipocalin-2, 24p3, MSFI, LCN2
SWISS: P30152
GeneID: 170496
Species: Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3]. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in Lipocalin2. It binds >51330 μM of Fe(DHBA)3.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris,500mM NaCl, pH 7.0Contact us for customized product form or formulation.
Antigen Sequence: QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only