WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat Sclerostin/SOST Protein - RP01583

Recombinant Rat Sclerostin/SOST Protein - RP01583

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Rat Sclerostin/SOST Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01583-10, RP01583-20, RP01583-50, RP01583-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat Sclerostin/SOST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Tyr213) of rat Sclerostin/SOST (Accession #NP_085073.1) fused with a 6×His tag at the C-terminus.

Alternate Names: sclerostin, SOST, VBCH, SOST

SWISS: Q99P67

GeneID: 80722

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only