ABclonal
Recombinant Rat Sonic hedgehog N-product/SHH Protein - RP01896
Recombinant Rat Sonic hedgehog N-product/SHH Protein - RP01896
Couldn't load pickup availability
Recombinant Rat Sonic hedgehog N-product/SHH Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01896-10, RP01896-20, RP01896-50, RP01896-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat Sonic hedgehog N-product/SHH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gly198) of Rat Sonic hedgehog /SHH (Accession #NP_058917.1) fused with a His tag at the C-terminus.
Alternate Names: Shh, Vhh-1, Sonic hedgehog protein, SHH, 3.1.-.-, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC, Cleaved into: Sonic hedgehog protein N-product, ShhN, Shh N-terminal processed signaling domains, ShhNp
SWISS: Q63673
GeneID: 29499
Species: Rat
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Sonic Hedgehog Protein (SHH, VHH-1) belongs to hedgehog protein family which includes Indian Hh, and Desert Hh. Hh family is involved in the cell fate and patterning during embryonic development, homeostasis, and adult tissue renewal. Similar to other member in the family, SHH binds to the patched (PTC) cell surface receptor, releasing the signal transducer Smoothened (Smo) to transmit the Hh signal into the cell and activate transcription of the target gene. Precursor SHH is autocatlytically cleaved into two subunits, N-terminal and C-terminal products. Soluble N-terminal product is involved in the signaling activity, while C-product displays an autoproteolysis activity on the precursor and a cholesterol transferase activity on the N-terminal product. C-terminal product attaches a cholesterol moiety to the N-terminal product, preventing N-terminal product diffusion within the developing embryo. A defect in SHH has been linked in holoprosencephaly type 3 (HPE3), in which developing forebrain fails to separate into right and left hemispheres, and ocular coloboma.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ACGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
