Skip to product information
1 of 1

ABclonal

Recombinant Rat Thrombopoietin /THPO / TPO Protein - RP01901

Recombinant Rat Thrombopoietin /THPO / TPO Protein - RP01901

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Rat Thrombopoietin /THPO / TPO Protein Sizes: 10ug, 20g, 50ug, 100ug Catalogue Numbers: RP01901-10, RP01901-20, RP01901-50, RP01901-100 Citations, Manuals and MSDS Available upon request. Description: Recombinant Rat THPO / TPO / Thrombopoietin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Ser326) of Rat THPO / TPO / Thrombopoietin (Accession #NP_112395.1) fused with a His tag at the C-terminus. Alternate Names: Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; megakaryocyte stimulating factor; MGDF; MGDFC-mpl ligand; MKCSF; MK-CSF; ML; MPL ligand; MPLLG; MPLLGMGC163194; Myeloproliferative leukemia virus oncogene ligand; THCYT1; THPO; thrombopoietin nirs variant 1; Thrombopoietin; Tpo; TPOMKCSF SWISS: P49745 GeneID: 81811 Species: Rat Purity: ≥ 95% as determined by SDS-PAGE. Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week. Background: Thrombopoietin (Tpo), is a key regulator of megakaryocytopoiesis and thrombopoiesis. It is principally produced in the liver and is bound and internalized by the receptor Tpo R/cmpl. Defects in the TpoTpo R signaling pathway are associated with a variety of platelet disorders. Mature rat Tpo shares 68% and 81% aa sequence homology with human and mouse Tpo, respectively. It is an 8085 kDa protein that consists of an Nterminal domain with homology to Erythropoietin (Epo) and a Cterminal domain that contains multiple Nlinked and Olinked glycosylation sites. Tpo promotes the differentiation, proliferation, and maturation of megakaryocytes (MK) and their progenitors. Several other cytokines can also promote these functions but only in cooperation with Tpo. Notably, IL3 independently induces MK development, although its effects are restricted to early in the MK lineage. Tpo additionally promotes platelet production, aggregation, ECM adhesion, and activation. These actions, in combination with direct effects on cardiomyocytes, can aid in the recovery of heart function following myocardial infarction. Tpo is cleaved by plateletderived thrombin following Arg191 within the Cterminal domain and subsequently at other sites upon extended digestion. The Cterminal domain is not required for binding to Tpo R or inducing MK growth and differentiation. Aside from its hematopoietic effects, Tpo is expressed in the brain where it promotes the apoptosis of hypoxiasensitized neurons and inhibits neuronal differentiation by blocking NGFinduced signaling. Bio-Activity: Measured in a cell proliferation assay using M07e human megakaryocytic leukemic cells. The ED50 for this effect is 0.26-1.02 ng/mL, corresponding to a specific activity of 9.8×10^5 ~3.8×10^6 units/mg. Source: HEK293 cells Tag: C-His Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Antigen Sequence: SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKFPNRTSGLLETNFSVVARTAGPGLLNRLQGFRAKIIPGQLNQTSGSLDQIPGYLNGTHEPVNGTHGLFAGTSLQTLEAPDVVPGAFNKGSLPLNLQSGLPPIPSLAADGYTLFPPSPTFPTPGSPPQLPPVS Endotoxin: < 0.01 EU/μg of the protein by LAL method Research Use Only
View full details