ABclonal
Recombinant Rat TNFRSF17/BCMA/CD269 Protein - RP01922
Recombinant Rat TNFRSF17/BCMA/CD269 Protein - RP01922
Couldn't load pickup availability
Recombinant Rat TNFRSF17/BCMA/CD269 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01922-10, RP01922-20, RP01922-50, RP01922-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Recombinant Rat TNFRSF17/BCMA/CD269 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Thr49) of Rat TNFRSF17/BCMA/CD269 (Accession #NP_001099231.1) fused with a hFc tag at the N-terminus.
Alternate Names: Tnfrsf17, TNF receptor superfamily member 17
SWISS: D3ZKQ8
GeneID: 287034
Species: Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), also known as B cell maturation antigen (BCMA) or CD269 antigen, is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature Blymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13BBAFF), and to lead to NF kappaB and MAPK8/JNK activation. TNFRSF17/BCMA/CD269 also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. TNFRSF17/BCMA/CD269 is a receptor for TALL-1 and BCMA activates NF-kappaB through a TRAF5-, TRAF6-, NIK-, and IKK-dependent pathway. The identification of TNFRSF17 as a NF-kappaB-activating receptor for TALL-1 suggests molecular targets for drug development against certain immunodeficient or autoimmune diseases. TNFRSF17/BCMA is a target of donor B-cell immunity in patients with myeloma who respond to DLI. Antibody responses to cell-surface BCMA may contribute directly to tumor rejection in vivo.
Source: HEK293 cells
Tag: N-hFc
Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: MAQRCFHSEYFDSLLHACKPCRLRCSNPPAPCQPYCDPSMTSSVRGTYT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
