ABclonal
Recombinant Rat TROP-2/TACSTD2 Protein - RP01455
Recombinant Rat TROP-2/TACSTD2 Protein - RP01455
Couldn't load pickup availability
Recombinant Rat TROP-2/TACSTD2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01455-10, RP01455-20, RP01455-50, RP01455-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat TROP-2/TACSTD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln25-Gly270) of rat TROP-2/TACSTD2 (Accession #NP_001009540.2) fused with a 6×His tag at the C-terminus.
Alternate Names: Prp1, Trop2, TROP2
SWISS: Q6P9Z6
GeneID: 494343
Species: Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: TROP-2, also referred to as tumor-associated calcium signal transducer 2 (TACSTD2), GA733-1 or M1S1, is a cell surface glycoprotein highly expressed in a wide variety of epithelial cancers. In contrast, there is little or no expression of Trop-2 in adult somatic tissue. Because it is a cell surface protein that is selectively expressed in tumor cells, Trop-2 is a potential therapeutic target. The cytoplasmic tail of Trop-2 possesses potential serine and tyrosine phosphorylation sites and a phosphatidyl-inositol binding consensus sequence. Trop-2 transduces an intracellular calcium signal, which are consistent with the hypothesis that it acts as a cell surface receptor and support a search for a physiological ligand. TROP2 encoding by an intronless gene was originally defined by the monoclonal antibody GA733, and is a member of a family of at least two type I membrane proteins. The other known member is GA733-2, also called EpCAM and TROP1. It has been suggested by studies that the GA733-1 gene was formed by the retroposition of the GA733-2 gene via an mRNA intermediate.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QINCTCPTNKMTICNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
